International Immunology, Vol. 13, No. 7, 897-908,
July 2001
© 2001 Japanese Society for Immunology
Mechanisms of cytokine synergy essential for vaccine protection against viral challenge
Molecular Immunogenetics and Vaccine Research Section Metabolism Branch, National Cancer Institute, National Institute of Health, Bldg 10, Rm 6B-12 (MSC#1578), Bethesda, MD 20892, USA
Correspondence to: J. A. Berzofsky
| Abstract |
|---|
|
|
|---|
The ability of cytokines to steer CD4+ Th cell responses toward a Th1 or Th2 phenotype and enhance the magnitude of both CD8+ cytotoxic T lymphocytes (CTL) and antibody responses has clearly been demonstrated by our lab and others, but the influence of cytokines on protective immune responses is much less clear. Here we show an essential role for CD4+ Th1 helper cell induction and IFN-
production in protection from viral challenge with a recombinant vaccinia virus expressing HIV-1MN viral envelope glycoprotein gp160. Complete protection from viral challenge is achieved only when the triple combination of exogenous cytokines granulocyte macrophage colony stimulating factor (GM-CSF), IL-12 and tumor necrosis factor (TNF)-
are co-administered with the peptide vaccine. In vivo depletion of CD4+ cells or immunization of IFN-
-deficient mice abrogates protection. GM-CSF, IL-12 and TNF-
also synergize for the enhanced induction of CTL; however, adoptive transfer of a CD8+ CTL line afforded only partial protection in this viral challenge model. As a possible mechanism of in vivo protection we show that GM-CSF increases the percentage and activity of antigen-presenting dendritic cells in draining lymph nodes where the immune response is initiated. We further demonstrate synergy between IL-12 and the proinflammatory cytokine TNF-
in driving IFN-
production. Thus, a combination of IL-12 and TNF-
is essential for the optimal development of Th1 responses and help for CTL induction in BALB/c mice, and is complemented by a third cytokine, GM-CSF, which enhances antigen presentation.
Keywords: cytokines, cytotoxic T lymphocyte, Th1 cells, viral immunity
| Introduction |
|---|
|
|
|---|
Previously we have shown that granulocyte macrophage colony stimulating factor (GM-CSF) and tumor necrosis factor (TNF)-
each synergize with IL-12 in the induction of cytotoxic T lymphocytes (CTL) when included with a ThCTL peptide vaccine construct delivered in an emulsion adjuvant, and that TNF-
and IL-12 synergize for IFN-
production, skewing the CD4+ cell response to Th1 in BALB/c mice (1). However, we did not study the protective efficacy of this combination of cytokines or the mechanisms of synergy or protection. It is clear from this study and those of other groups that exogenous cytokines are a valuable adjunct to present vaccine modalities aimed at eliciting both optimum cellular and humoral immune responses and protection (110). More recently, the expression of cytokine combinations with co-stimulatory molecules, CD40 ligand (CD40L) or CTLA-4 blockage have proven effective in eliciting anti-tumor CTL responses (1114). The potential effectiveness of cytokine combinations and co-stimulatory molecules or dendritic cell vaccines has mostly been determined empirically based upon mechanisms determined in vitro for Th cell differentiation and CTL induction. The mechanisms of cytokine combinations in protective studies in vivo, however, have not been clearly defined. Here, we address the ability of cytokines in vaccine formulations to protect against viral infection, and the mechanisms of protection and synergy.
Previous work with our ThCTL peptide constructs has shown a strict requirement for CD4+ T cell help in the production of neutralizing antibody and the induction of CTL (1517). In vitro studies suggest that an optimum CTL response requires the concerted, reciprocal interaction of CD4+ Th cells, dendritic cells and CD8+ CTL (1823). Dendritic cells play a central role in induction of cellular immune responses (24) and maturation of dendritic cells to a fully functional state requires activation via CD40CD40L interaction (2527). The mature dendritic cell possesses the requisite co-stimulatory molecules and secretes IL-12 and IL-15 for differentiation and proliferation of both Th1 CD4+ cells and CD8+ CTL (2830). CD4+ help for CTL can be bypassed by antigen-presenting cells (APC) infected by viruses which subserve these functions (31) or immunization with `mature' dendritic cells (26,3234). Although the role of CD4+ T cells versus CD8+ CTL in viral protection models is complex and depends on the nature of viral infection (3538), recent findings suggest the survival and efficacy of CD8+ CTL may be inextricably linked to CD4+ cell function (37,3941). CD4+ Th cells have been shown to play a critical role in clearance of a number of viral infections by providing either help for neutralizing antibody production (40,42,43), IFN-
mediated antiviral effects (4447) or help for CTL (16,17). Recently a role for CD4+ cells in maintaining CD8+ CTL effector function and memory in persistent viral infections has also been shown (4851).
It is generally assumed that Th1 differentiation favors CTL induction (52,53), whereas Th2 cells are inhibitory, possibly due to the suppressive effects of IL-10 on APC function (54,55). Th cell differentiation is highly regulated by cytokines present during initiation of the immune response (56). IL-12 acts directly on CD4+ cells to enhance priming for IFN-
production (57,58); however, Th1 development appears to require both IL-12 and IFN-
(59,60). IL-4 selects for acquisition of a Th2 phenotype (61), and most importantly IL-4 and IFN-
exert reciprocal inhibition of Th1 and Th2 phenotypes respectively (58,6264).
In this study, we have now investigated the ability of cytokines and combinations of cytokines not only to induce both CD4+ and CD8+ cell-mediated immunity but also to protect against viral challenge, as well as examined the mechanism of synergy and protection. We have optimized our immunization protocol by including cytokines which localize and mature dendritic cells at the inductive site, and skew the immune response toward a CD4+ Th1 phenotype and CTL induction. We show that appropriate inflammatory cytokines are essential for the induction of a protective cellular immune response in this viral challenge model. Optimum induction of CTL requires the addition of exogenous cytokines GM-CSF, IL-12 and TNF-
, although the avidity of CTL elicited by peptide vaccine is not directly affected by exogenous cytokines delivered during immunization. Furthermore, we have shown that complete protection against challenge with a recombinant vaccinia virus expressing the HIV1-MN envelope protein gp160 is dependent upon the synergy of cytokines with TNF-
during immunization that skew the response toward Th1 cell IFN-
production.
| Methods |
|---|
|
|
|---|
Animals
Female BALB/c mice were used at 68 weeks of age (Animal Production Colonies, Frederick Cancer Research Facility, National Institutes of Health, Frederick, MD) for immunizations. All procedures with animals were carried out in accordance with institutionally approved protocols. IFN-
knockout mice on the BALB/c background were obtained from Jackson Laboratory (Bar Harbor, ME).
Immunizations and viral challenge
Mice were immunized with 20 nmol of the ThCTL vaccine construct PCLUS 6.1-18MN (DRVIEVVQGAYRAIRHIPRRIRQGLERRIHIGPGRAFYTTKN), comprised of Th determinants from HIV-1 IIIB env sequence 827853 linked to the CTL determinant P18MN shown in bold, amino acid residues 308322), s.c. at the base of the tail in incomplete Seppic adjuvant (montanide ISA-51; a kind gift of Jean-Pierre Planchot, Seppic, Fairfield, NJ). Cytokines were included with peptide in the aqueous phase before mixing with the adjuvant to form a water in oil emulsion. Cytokines used in immunizations included GM-CSF (Peprotech, Rocky Hill, NJ) (35 µg/mouse), IL-12 (Genetics Institute, Cambridge, MA) (35 µg/mouse) and TNF-
(R & D Systems, Minneapolis, MN) (0.5 µg/mouse). Mice were boosted 2 weeks after the primary immunization and challenged i.p. 12 days later with recombinant vaccinia virus (5x106 p.f.u./mouse) expressing the HIV-1MN envelope protein gp160 (Vaccinia-MN was a kind gift of Bernard Moss, NIAID). Five days later virus titers in the ovaries of individual mice were determined on BSC-1 indicator cells as previously described (83). In vivo depletion of CD4+ and/or CD8+ cells was achieved by four consecutive i.p. doses of 0.5 mg/mouse/day of anti-CD4 (clone GK1.5) or anti-CD8 antibody (clone 2.43) beginning 2 days prior to viral challenge. Depleted cells were not detected, by FACS analysis, in spleens of treated mice (<0.5%) up to 6 days after treatment.
Lymph node cultures
Medium for incubation of mouse cell cultures consisted of RPMI:EHAA 50:50, supplemented with 2 mM L-glutamine, 100 µg/ml streptomycin,100 IU/ml penicillin G and 5x105 M 2-mercaptoethanol. Triplicate cultures of inguinal and subaortic lymph node cells from BALB/c mice injected 2 days previously with GM-CSF in adjuvant montanide ISA-51 or adjuvant alone were depleted of T and B cells using magnetic-coated beads (Dynal, Lake Success, NY) and plated in 96- well flat-bottom wells at 5x105 APC/well with and without antigen. The two different APC populations were assessed for their ability to support proliferation of a Th cell clone by adding 3x104 CD4+ Th1 cells, derived from BALB/c mice specific for the HIV-1bru peptide nef (182198) and cloned by limiting dilution. Cells were harvested 72 h later after an 8 h pulse with 1 µCi [3H]thymidine. Geometric mean c.p.m. ± SEM were plotted versus peptide dose. As a readout of CD8+ CTL activation, IFN-
production was measured in culture supernatants 60 h after in vitro stimulation of 5x104 CD8+ CTL added to 5x105 lymph node APC/well pulsed for 3 h with 0.5 or 0.05 µM P18MN
Semiquantitative RT-PCR
Total RNA was isolated from CD4+ T cells positively selected by magnetic beads (Dynal) followed by immediate lysis in guanidinum thiocyanate followed by acid phenolchloroform extraction and precipitated overnight at 20°C with isopropanol. mRNA was reversed transcribed from 25 µg of total RNA using Superscript II first-strand cDNA synthesis kit (Life Technologies, Grand Island, NY).
The following primer pairs were constructed using complete coding sequences for the housekeeping gene: HPRT forward GTTGGATACAGGCCAGACTTTGTTG; HPRT reverse TCGGTATCCGGTCGGATGGGAG generated a single PCR product of 450 bp. Murine cytokine primers and controls IL-2, IL-4, IL-10 and IFN-
(Clontech Laboratories, Palo Alto, CA) were used at a concentration of 0.4 µM/30 µl reaction. Approximately 1 µg of cDNA was added to 30 µl Superscript PCR buffer (Life Technologies) with an additional 1 mM MgCl plus primers (0.4 µM/reaction) plus primers. PCR was performed for 30 cycles using the following parameters: 94°C, 30 s; 60°C, 1 min; 72°C, 1 min extended to 5 min during the last cycle. PCR products were run on 10% TBE gels for 1.5 h, stained for 10 min with Vistra Green (Amersham, Arlington Heights, IL) and fluorescent bands scanned using a phosphofluroimager (Molecular Dynamics, Sunnyvale CA). Semiquantitative analysis for expression of the gene of interest was made by normalization to HPRT, housekeeping gene expression.
ELISA assay
Aliquots of 100 µl of 4872 h culture supernatants from lymph node or spleen cell cultures stimulated in vitro with helper peptide PCLUS 6.1 or CTL epitope P18MN were tested in an IFN-
ELISA assay (Life Technologies) according to the manufacturer's instructions. Standards were curve-fit to a four-parameter logistic function and sample concentrations (ng/ml) interpolated from the standard curve.
CTL assay
Bulk spleen cell populations from immunized mice were re-stimulated in vitro with peptide-pulsed (0.5 µM P18MN for 2 h) spleen cells in 12-well plates (Costar). To 1x107 spleen cells from immunized mice was added 1x107 irradiated (3000 rad) peptide-pulsed syngeneic spleen cells. After 20 h Rat T Stim (Collaborative Biomedical, Bedford, MA) was added as a source of IL-2 to a final concentration of 7.5%. Four days later non-adherent cells were spun over mouse Lympholyte M (Cedarlane, Hornby, Ontario, Canada), replated and 2.5 U/ml recombinant murine IL-2 added. Cells were harvested on day 78 to test for CTL activity. Triplicate cultures of effector cells were diluted in 96-well round-bottom plates and 5000 target cells were added. Effector cells were tested against target cells, 18Neo (3T3 fibroblasts transfected with the neomycin gene) and P18MN-pulsed 18Neo cells in a 5-h assay. Spontaneous lysis of 51Cr-labeled target cells did not exceed 10%. Percent specific lysis was calculated as (c.p.m. of peptide-pulsed targets c.p.m. of 18Neo without peptide)/(total c.p.m. spontaneous c.p.m.)x100.
Statistical analysis
Means were plotted as geometric or arithmetic based on the distribution of data within an experimental set, as determined by the ShapiroWilk test.
means represent the experimental no antigen control mean of triplicate samples. A two-way analysis of variance was applied to CTL data, thereby averaging the respective values for each curve over all the E:T ratios. Means for each treatment were compared using Tukey's multiple comparison test or Dunnett's method and significance determined at
= 0.05. IFN-
data was treated similarly or by the Student's t-test at a P value of.01. Departures from additivity (synergism or antagonism) were assessed using the construct AB + control A B or for triple synergy ABC + control A B C, where A, B and C denote individual treatment factors, and AB and ABC denotes the combination. Statistical analysis was performed using the JMP Statistical Software Program (SAS Institute, Cary, NC) on a Macintosh computer.
| Results |
|---|
|
|
|---|
Triple cytokine combination enhances CTL induction
Previously we have shown that GM-CSF and TNF-
each synergize with IL-12 in the induction of CTL when included in the immunization with a ThCTL vaccine construct in an emulsion adjuvant. Since we hypothesized that GM-CSF and TNF-
each synergize with IL-12 for induction of CTL by different mechanisms, we tested whether the combination of all three cytokines would enhance CTL induction. The combination of exogenous cytokines, GM-CSF, TNF-
and IL-12, leads to enhanced CTL induction following a single s.c. immunization and further increased the magnitude of the CTL response after two immunizations (Fig. 1A and B
and IL-12 at all E:T ratios. Synergism was seen with all cytokine combinations, GM-CSF and IL-12, TNF-
and IL-12, and the triple cytokine combination GM-CSF, IL-12, and TNF-
at 0.05 µM peptide-pulsed targets in Fig. 1
was only effective over a narrow dose (0.10.5 µg/dose), as higher doses were inhibitory or toxic.
|
Since the avidity of CD8+ CTL may better define a protective immune response than the magnitude of the response in protection from viral challenge, we wanted to determine if the avidity of CTL elicited following immunization was affected by exogenous cytokines included in the immunization. We therefore titrated the CTL response versus peptide concentration. Although the magnitude of CTL elicited differed among immunization groups, the avidity of CTL was similar regardless of which cytokines were included in the immunization (Fig. 1C
Protection from recombinant vaccinia virus gp160MN viral challenge requires the triple cytokine combination and is mediated by IFN-
production by CD4 cells
Since protection against viral challenge had not been measured in this system previously, we asked whether vaccination with peptide and any combination of cytokines would protect against challenge with a recombinant vaccinia virus expressing HIV-1 gp160. It was important to determine whether and by what mechanism cytokines or combinations of cytokines might render a non-protective cellular immune response into a protective one. Immunized animals were challenged i.p. with a recombinant vaccinia virus expressing the envelope protein gp160 of HIV-1MN. Strikingly, protection from high-dose viral challenge was achieved in only two groups of mice, those which received either the combination of exogenous cytokines IL-12 and TNF-
or the triple combination GM-CSF, IL-12 and TNF-
(Fig. 2A and B
). Furthermore, complete protection was consistently achieved after two immunizations only in the group receiving the triple cytokine combination (23 of 27 animals compared to five of 13 receiving IL-12 and TNF-
) (Fig. 2B
). Complete protection was defined as the reduction in viral titer below the limit of detection (102 p.f.u./ovary). Despite enhanced CTL responses in animals immunized with the peptide vaccine plus GM-CSF and IL-12, little or no protection was seen with this cytokine combination in this viral challenge model. Thus, surprisingly, enhancement in protection did not strictly correlate with enhancement of CTL response. While several cytokine combinations enhanced CTL, protection in vivo was more discriminating and was consistently achieved only with the triple combination, showing clearly the synergy of all three cytokines.
|
To determine which T cells were responsible for mediating protection, animals receiving PCLUS 6.1-18MN plus the triple cytokine combination GM-CSF, IL-12 and TNF-
were depleted of CD4+ or CD8+ cells for 4 consecutive days beginning 2 days prior to viral challenge. Eight out of 10 animals receiving peptide plus the triple cytokine combination were completely protected, whereas complete protection was not obtained in any of the animals depleted of CD4+ cells (Fig. 3A
appeared to be necessary for protection since neutralization of IFN-
by a single dose of antibody was sufficient to abrogate protection. Therefore, we tested IFN-
knockout mice for protection following two immunizations with the triple cytokine combination. None of these animals were protected from a viral challenge, confirming the importance of IFN-
(Fig. 3A
.
|
To directly determine what role CD8+ CTL might also play, we adoptively transferred 7x106 cells of a P18MN-specific CD8+ CTL clone (i.v) and challenged i.p. with virus (Fig. 3B
production by CD4+ cells. CD8+ CTL lines derived from immunized mice were capable of producing high levels of IFN-
and partial protection in unimmunized mice from viral challenge was achieved following adoptive transfer of a CD8+ CTL clone. We did not determine whether the protection achieved by adoptive transfer of the CD8+ CTL clone was attributable to the high levels of IFN-
production following stimulation in vivo or direct killing of virus-infected cells.
We have shown in Fig. 3
(B) that adoptive transfer of a CD8+ CTL line reduces the viral titer by ~100-fold, but it is possible that more cells, or cells that trafficked more efficiently to the site of viral replication (the ovaries), would be more effective. We have not transferred bulk immune spleen cells. However, we have found, in unpublished results, that if we immunize s.c. and challenge i.p., the protection is dominated by CD4+ cells as shown in Fig. 3
, but if we immunize i.p. and challenge i.p., then CD8+ cells play a more dominant role. Although we have not been able to establish the mechanism of this difference, we believe it is likely to depend on the trafficking of the CD8+ T cells, that may depend on the site of deposition of the antigen. Therefore, we believe that this finding supports the conclusion that both CD4+ and CD8+ cells contribute to the protection, and their relative importance depends on trafficking.
To understand the mechanism of synergy among these cytokines for enhancing immune responses and also protection, we examined the mechanistic role of each cytokine.
GM-CSF treatment enhances the cellular immune response by recruiting APC precursors to draining lymph nodes.
Since GM-CSF when included with peptide immunization was effective in enhancing both proliferative and CTL responses, we performed a simple experiment to evaluate its mechanism of action. Although it has been presumed to act by enhancing antigen presentation, this assumption has never been tested directly, to our knowledge. Lymph node cells from mock-treated and GM-CSF-treated animals were tested for their functional ability to stimulate proliferation of a CD4+ T cell clone and IFN-
production by a CD8+ CTL clone (Fig. 4
). T cell-depleted lymph node cells from GM-CSF-treated animals elicited both a more potent and efficient proliferative response of a CD4+ T cell clone specific for HIVbru (nef 182198) than lymph node cells from mock-treated animals (Fig. 4A
). Approximately 30 times less peptide was required to elicit similar proliferation at low-dose peptide (compare curves at 50x103 c.p.m.) and the maximum proliferative response could not be obtained with lymph nodes from mock-treated animals at any peptide concentration.
|
Similar results were obtained with a CD8+ CTL clone as an indicator. Lymph node cells from GM-CSF-treated animals elicited significantly greater IFN-
production at both the optimum stimulating dose of 0.5 µM P18MN and 1 log lower dose peptide (P < 0.001) (Fig. 4B
increases the number of CD11c+ dendritic cells. However, we find that only the triple combination, not the double, also results in a marked increase in CD11b+ macrophages, which may contribute to protection by making oxidative effector molecules in response to the IFN-
. There was a proportional increase in the number of cells expressing B7-1 from ~8% in animals treated with GM-CSF or IL-12/TNF-
to 28% of class II+ cells in animals treated with the triple cytokine combination. Although we observed an increase in CD11C+ cells in draining lymph nodes when animals were treated with carrier-free GM-CSF in ISA-51, there was not an increase in co-stimulatory molecules B7-1, B7-1, ICAM or the class I Dd molecule, or CD40 expression on these cells in the absence of Th-dependent or Th-independent activating factors (data not shown). These data clearly demonstrate the role of GM-CSF in enhancing the magnitude of cellular immune responses through the recruitment of antigen-presenting dendritic cells to the inductive site of the immune response and Th-dependent maturation following antigen presentation as well.
TNF-
synergizes with IL-12 in selecting a CD4+ cell Th1 phenotype
Because protection was dependent on CD4+ T cells and on IFN-
, we investigated the role of the cytokine synergy in enhancing the response of CD4+ T cells that make this cytokine, Th1 cells. To determine Th cell phenotypes we immunized animals with peptide vaccine plus cytokines, and performed RT-PCR for cytokine message expression and IFN-
production following 24 h in vitro stimulation of 7-day draining lymph node cells with the helper peptide PCLUS 6.1 (Fig. 5A and C
). Peptide vaccine alone without cytokines elicited a Th2-like response: IL-4, low IFN-
expression and a weak proliferative response (Fig. 5A and B
). Individual cytokines, GM-CSF, IL-12 or TNF-
lead to a mixed response. GM-CSF was noteworthy in enhancing IL-4 expression (1.9-fold) and IL-10 (2.3-fold) compared to peptide alone, as well as enhancing IL-2 and proliferation. Significantly, GM-CSF alone did not enhance IFN-
production by a population of bulk CD4+ cells. Only CD4+ cells from mice immunized with PCLUS 6.1-18MN plus the combination of cytokines TNF-
and IL-12 or TNF-
, GM-CSF and IL-12 showed evidence of skewing toward a Th1 response as determined by the up-regulation of IFN-
message by CD4+ T cells (19- and 12-fold increase respectively, relative to peptide alone). Although all groups receiving single cytokines showed enhanced expression of IFN-
compared to peptide alone (3.8- to 5.6-fold increase) only animals receiving IL-12 and TNF-
or GM-CSF, IL-12 and TNF-
showed significant increases in IFN-
production after in vitro stimulation (Fig.5C
). IL-4 was slightly enhanced in both groups (<2-fold), whereas IL-10 was enhanced 2.4-fold in animals receiving the triple cytokine combination. CD4+ cell proliferation was also higher in these two groups (Fig.5B
). Similar results were seen in lymph nodes at day 10.
|
Since message expression and in vitro production of IFN-
were routinely highest in animals receiving the combination IL-12 plus TNF-
, yet protection from viral challenge was most consistently achieved with the triple cytokine combination in which CTL were the highest, this suggested a role for CD8+ cells not revealed in the depletion experiments. Therefore, we did a side by side comparison of IFN-
production in bulk spleen cell cultures stimulated with helper peptide or the CTL epitope. Consistent with previous results, CD4+ cell IFN-
production was significantly increased over control peptide, and all other groups after a single immunization and after boosting when TNF-
and IL-12 or GM-CSF, IL-12 and TNF-
were included in the immunization (Fig. 6A
were significantly lower than seen in the CD4+ cell response (Fig. 6B
mediated, and only partial protection was achieved following adoptive transfer of CD8+ CTL, either more CD4+ T cells are activated to produce IFN-
at the site of viral challenge than the number of CD8+ T cells adoptively transferred or the ability of the adoptively transferred CD8+ T cells to effectively migrate to the site during initial viral infection maybe limiting. Also a direct role of CD8+ CTL lysis of virus-infected cells, not revealed by in vivo depletion, may explain the difference in protection between those animals receiving IL-12 and TNF-
versus triple cytokine treatment since IFN-
production was similar in both groups. We are further investigating this possibility. The only difference found between these two groups was a higher level of CTL induction in animals receiving peptide vaccine plus the triple cytokine combination.
|
| Discussion |
|---|
|
|
|---|
In this study we have shown an essential role for novel cytokine synergies in eliciting maximal CD8+ CTL responses and CD4+ Th1 effector cell responses capable of complete protection from a recombinant vaccinia viral challenge, and we have examined the mechanism of this synergy and protection. Previous studies by ourselves (1,88) and others (7,8,68,69) have shown enhancement of CTL responses by cytokines and have detected some bilateral synergies, but the mechanisms of CTL enhancement or of synergistic interactions was not determined. Further, synergistic effects on protection against viral infection have not been demonstrated previously. The current study focuses on these two issues: synergistic effects on protection from viral infection and the mechanisms of cytokine synergy and protection.
We show here that by optimizing the combination of cytokines used in the adjuvant (GM-CSF, IL-12 and TNF-
) enhanced CTL induction occurs and protection is achieved. However, this correlation does not imply that CTL are the major mechanism of protection. Previously we have demonstrated a role for CD8+ CTL in protection from recombinant vaccinia viral challenge (6567) and, in this study, adoptive transfer of a CD8+ CTL clone into unimmunized mice led to partial protection. However, we have not previously seen complete protection by CD8+ CTL achieved in this challenge model. CD8+ CTL undergo a massive burst following a number of virus infections and have been suggested to play a major role in the control of many persistent viral infections (7073). The subsequent fate of CD8+ CTL and the ability to control or eliminate infection may be dependent upon the initial viral load and the concerted interactions between T cells and APC, co-stimulation, and cytokine combinations which support maximum induction, and survival of activated CTL. Clearly when CD4+ cell function is compromised, as in disease progression toward AIDS, the CD8+ CTL response is inadequate for disease control (37,49). Since it appears that events occurring during a narrow window of time during the initial infection are critical in the development of persistent or latent infections, the challenge for prophylactic vaccine development is to insure a fully functional CD4+ and CD8+ CTL repertoire at the site of initial infection that could eliminate virus-infected cells before development of escape mutants (49,67,7477) and dissemination of the virus systemically. Both CD8+ CTL and CD4+ cells are considered to play a significant role in the control of viremia and persistent infection with HIV. In this study, although cytokine combinations have been shown to quantitatively enhance T cell responses and vaccine efficacy, it is clear from this study and our previous studies that a protective CD8+ CTL response requires that activated CTL are present, in adequate numbers, locally at the site of viral challenge (66,67,78). In the recombinant HIV-1 gp160 vaccinia model system used in this study, adoptive transfer of a CD8+ CTL clone directed to the recombinant protein provided partial protection in a self-limiting infection, but was not robust enough to completely eliminate virus within the first few days following viral challenge.
However, surprisingly, CD4+ cells play a more direct role here than just maintenance of CD8+ T cell activity. We show here that CD4+ T cells are the predominant effector cell mediating protection. The mechanism appears to be IFN-
production, as shown by using both antibody blocking and knockout mice. This result is consistent with earlier studies showing an important role for IFN-
in controlling vaccinia infection (79).
In this study we further investigated the mechanisms of cytokine synergies responsible for eliciting a protective response. We demonstrated a sequential and concerted action of cytokine combinations in eliciting optimum CD4+ and CD8+ CTL responses. GM-CSF has been presumed to act as an adjuvant by mobilizing bone marrow myeloid-derived dendritic cell precursors to draining lymph nodes increasing the efficiency of antigen presentation for induction of cell-mediated immunity, but its mechanism of action as an adjuvant has never been directly tested to our knowledge. Although a number of studies have shown that GM-CSF enhances T cell responses, here we demonstrate experimentally that the mechanism does indeed involve enhancement of APC activity in the draining lymph nodes, enhancing stimulation of both a CD4+ Th1 cell and CD8+ CTL response. However, it is noteworthy to comment on the lack of protection achieved with the combination of cytokines GM-CSF and IL-12. Although GM-CSF enhances CD4 Th cell responses, neither GM-CSF or IL-12 alone or in combination were capable of skewing the response toward a Th1 phenotype and a population of IFN-
-secreting cells mediating protection.
TNF-
has been shown to have pleiotropic regulatory functions: enhancing APC function (80) and maturation of dendritic cells and IL-12 production (81,82). Furthermore, in vivo (1) and in vitro studies (83) have shown TNF-
to synergize with IL-12 for production of IFN-
and skewing of the Th response to Th1. TNF-
may act directly on T cells via the TNF-R either to provide a co-stimulatory signal or, dependent upon the state of activation, to induce apoptosis in established T cell lines or memory cells following antigen stimulation with high-dose antigen (84), although in this study we did not see inhibition of proliferative responses in CD4+ or CD8+ cell cultures by the addition of exogenous TNF-
. These results may explain the necessity of both an appropriate inflammatory response in which TNF-
is produced, and IL12 production by APC stimulated through CD40CD40L interaction, in initiating a Th1 response. TNF-
has also been shown to play a significant role in CTL induction in a graft versus leukemia mouse model (85). Since TNF-
may also be a contributing factor in apoptosis of activated T cells, the kinetics and level of TNF-
maybe a critical factor in the balance between proliferation, apoptosis and establishment of memory T cells. If TNF levels remain high during proliferation in the presence of high antigen levels, cell death may occur, diminishing the pool of memory T cells, whereas if TNF-
levels are controlled, maximum expansion of the precursor pool and memory will ensue.
IL-12 also has been shown to have pleiotropic functions, as an obligatory cytokine for induction of Th1 responses and induction of IFN-
, and as growth and survival factor for CD4+ and CD8+ CTL (29). Although IL-12 requires TNF-
as a cofactor in induction of IFN-
in BALB/c mice (1,86), studies have shown that IL-12 alone may be sufficient to drive Th1 responses in other inbred and congenic strains of mice (83). This enhanced Th1 response led to enhanced effector function in vivo, as well as mediating the maturation and conditioning of dendritic cell APC which enhanced the CTL response.
Here we have shown that TNF-
and IL-12 strikingly synergize for production of IFN-
(1 and present data). We hypothesized that the mechanism may involve a synergistic up-regulation of mRNA for IL-12ß2R by the combination of TNF-
and IL-12. In a follow-up study, we indeed found a direct synergistic effect of IL-12 and TNF-
on naive CD4+ cell IFN-
and IL-12ßR expression (J. D. Ahlers, I. M. Belyakov, S. Matsui and J. A. Berzofsky, submitted). Thus synergy for IFN-
production may be mediated by an enhanced sensitivity of CD4+ T cells for IL-12 induced by up-regulation of the IL-12 receptor. This in turn contributes to synergy for protection.
We conclude that protection against HIV gp160-expressing recombinant vaccinia virus in this system in which animals were immunized s.c. with peptide vaccine plus cytokines and challenged at a different site (i.p.) depends primarily on IFN-
production, which in this case is mediated primarily by CD4+ Th1 cells although CD8+ CTL can also do so. Three cytokines can synergize to maximize IFN-
production as well as CTL induction, and thus to provide the strongest and most robust protection against viral challenge. We have shown that these cytokines act by complementary mechanisms, GM-CSF to increase the antigen-presenting activity of dendritic cells, TNF-
to act with IL-12 in up-regulating IFN-
production.
We find that only the triple combination, not the double combination, not only gives an increase in the number of dendritic cells (CD11c+) in the draining lymph node, which can contribute to the magnitude of the immune response, but also gives an increase in the number of CD11b (Mac-1)+ macrophages, which might play a functional role in protection by making oxidative effector molecules in response to the IFN-
. Thus, the combination of the high IFN-
with the presence of macrophages that can carry out downstream effector functions in response to the IFN-
, may provide an explanation for the difference in protection seen between the triple cytokine combination GM-CSF, IL-12 and TNF-
compared to immunization with IL-12 and TNF-
.
Since incomplete Freund's adjuvant, like the emulsion adjuvant ISA-51 used in this study, has been shown to influence development of a Th2 phenotype following immunization with protein antigens (87), appropriate combinations of cytokines can exert a powerful selective influence on the developing immune response in vivo independent of the adjuvant used. Vaccines that take advantage of these cytokines may be able to maximize protection without the need for adjuvants that induce an inflammatory response with more severe side effects.
| Acknowledgments |
|---|
We thank Drs Alan Sher and William E. Paul for critical reading of the manuscript and helpful suggestions. We thank Drs Bernard Moss and Patricia Earl for the recombinant vaccinia gp160MN virus, Dr Stanley Wolf and Genetics Institute for the kind gift of murine IL-12, and Lisa Smith for her assistance in preparation of this manuscript.
| Abbreviations |
|---|
| APC antigen-presenting cell |
| CD40L CD40 ligand |
| CTL cytotoxic T lymphocyte |
| GM-CSF granulocyte macrophage colony stimulating factor |
| ISA incomplete Seppic adjuvant |
| TNF tumor necrosis factor |
| Notes |
|---|
Transmitting editor: H. Wigzell
Received 30 August 2000, accepted 3 April 2001.
| References |
|---|
|
|
|---|
-
Ahlers, J. D., Dunlop, N., Alling, D. W., Nara, P. L. and Berzofsky, J. A. 1997. Cytokine-in-adjuvant steering of the immune response phenotype to HIV-1 vaccine constructs: GM-CSF and TNF-
synergize with IL-12 to enhance induction of CTL. J. Immunol. 158:3947.[Abstract]
-
Dranoff, G., Jaffee, E., Lazenby, A., Golumbek, P., Levitsky, H., Brose, K., Jackson, V., Hamada, H., Pardoll, D. and Mulligan, R. C. 1993. Vaccination with irradiated tumor cells engineered to secrete murine granulocyte-macrophage colony-stimulating factor stimulates potent, specific, and long-lasting anti-tumor immunity. Proc. Natl Acad. Sci. USA 90:3539.
[Abstract/Free Full Text] -
Brunda, M. J., Luistro, L., Warrier, R. R., Wright, R. B., Hubbard, B. R., Murphy, M., Wolf, S. F. and Gately, M. K. 1993. Antitumor and antimetastatic activity of interleukin 12 against murine tumors. J. Exp. Med. 178:1223.
[Abstract/Free Full Text] - Xiang, Z. and Ertl, H. C. J. 1995. Manipulation of the immune response to a plasmid-encoded viral antigen by coinoculation with plasmids expressing cytokines. Immunity 2:129.[Web of Science][Medline]
- Irvine, K. R., Rao, J. B., Rosenberg, S. A. and Restifo, N. P. 1996. Cytokine enhancement of DNA immunization leads to effective treatment of established pulmonary metastases. J. Immunol. 156:238.[Abstract]
-
Disis, M. L., Bernhard, H., Shiota, F. M., Hand, S. L., Gralow, J. R., Huseby, E. S., Gillis, S. and Cheever, M. A. 1996. Granulocyte-macrophage colony-stimulating factor: an effective adjuvant for protein and peptide-based vaccines. Blood 88:202.
[Abstract/Free Full Text] - Kim, J. J., Ayyavoo, V., Bagarazzi, M. L., Chattergoon, M. A., Dang, K., Wang, B., Boyer, J. D. and Weiner, D. B. 1997. In vivo engineering of a cellular immune response by coadministration of IL-12 expression vector with a DNA immunogen. J. Immunol. 158:816.[Abstract]
- Iwasaki, A., Stiernholm, B. J. N., Chan, A. K., Berinstein, N. L. and Barber, B. H. 1997. Enhanced CTL responses mediated by plasmid DNA immunogens encoding costimulatory molecules and cytokines. J. Immunol. 158:4591.[Abstract]
-
Jankovic, D., Caspar, P., Zweig, M., Garcia-Moll, M., Showalter, S. D., Vogel, F. R. and Sher, A. 1997. Adsorption to aluminum hydroxide promotes the activity of IL-12 as an adjuvant for antibody as well as type 1 cytokine responses to HIV-1 gp120. J. Immunol. 159:2409.
[Abstract/Free Full Text] -
Weiss, W. R., Ishii, K. J., Hedstrom, R. C., Sedegah, M., Ichino, M., Barnhart, K., Klinman, D. M. and Hoffman, S. L. 1998. A plasmid encoding murine granulocyte-macrophage colony-stimulating factor increases protection conferred by a malaria DNA vaccine. J. Immunol. 161:2325.
[Abstract/Free Full Text] -
Harding, F. A. and Allison, J. P. 1993. CD28B7 interactions allow the induction of CD8+ cytotoxic T lymphocytes in the absence of exogenous help. J. Exp. Med. 177:1791.
[Abstract/Free Full Text] - Rao, J. B., Chamberlain, R. S., Bronte, V., Carroll, M. W., Irvine, K. R., Moss, B., Rosenberg, S. A. and Restifo, N. P. 1996. IL-12 is an effective adjuvant to recombinant vaccinia virus-based tumor vaccines: enhancement by simultaneous B7-1 expression. J. Immunol. 156:3357.[Abstract]
-
Chiodoni, C., Paglia, P., Stoppacciaro, A., Rodolfo, M., Parenza, M. and Colombo, M. P. 1999. Dendritic cells infiltrating tumors cotransduced with granulocyte/macrophage colony-stimulating factor (GM-CSF) and CD40 ligand genes take up and present endogenous tumor-associated antigens, and prime naive mice for a cytotoxic T lymphocyte response. J. Exp. Med. 190:125.
[Abstract/Free Full Text] -
Hurwitz, A. A., Yu, T. F. -Y., Leach, D. R. and Allison, J. P. 1998. CTLA-4 blockade synergizes with tumor-derived granulocyte-macrophage colony-stimulating factor for treatment of an experimental mammary carcinoma. Proc. Natl. Acad. Sci. 95:10067.
[Abstract/Free Full Text] - Ahlers, J. D., Pendleton, C. D., Dunlop, N., Minassian, A., Nara, P. L. and Berzofsky, J. A. 1993. Construction of an HIV-1 peptide vaccine containing a multideterminant helper peptide linked to a V3 loop peptide 18 inducing strong neutralizing antibody responses in mice of multiple MHC haplotypes after two immunizations. J. Immunol. 150:5647.[Abstract]
- Shirai, M., Pendleton, C. D., Ahlers, J., Takeshita, T., Newman, M. and Berzofsky, J. A. 1994. Helper-CTL determinant linkage required for priming of anti-HIV CD8+ CTL in vivo with peptide vaccine constructs. J. Immunol. 152:549.[Abstract]
- Ahlers, J. D., Dunlop, N., Pendleton, C. D., Newman, M., Nara, P. L. and Berzofsky, J. A. 1996. Candidate HIV type1 multideterminant cluster peptide-P18MN vaccine constructs elicit type1 helper T cells, cytotoxic T cells, and neutralizing antibody, all using the same adjuvant immunization. AIDS Res. Hum. Retroviruses 12:259.[Web of Science][Medline]
-
Rissoan, M.-C., Soumelis, V., Kadowaki, N., Grouard, G., Briere, F., De Waal Malefyt, R. and Liu, Y.-J. 1999. Reciprocal control of T helper cell and dendritic cell differentiation. Science 283:1183.
[Abstract/Free Full Text] -
Bennett, S. R. M., Carbone, F. R., Karamalis, F., Miller, J. F. A. P. and Heath, W. R. 1997. Induction of a CD8+ cytotoxic T lymphocytes response by cross-priming requires cognate CD4+ T cell help. J. Exp. Med. 186:65.
[Abstract/Free Full Text] - Schoenberger, S. P., Toes, R. E. M., van der Voort, E. I. H., Offringa, R. and Melief, C. J. M. 1998. T cell help for cytotoxic T lymphocytes is mediated by CD40CD40L interactions. Nature 393:480.[Medline]
- Bennett, S. R. M., Carbone, F. R., Karamalis, F., Flavell, R. A., Miller, J. F. A. P. and Heath, W. R. 1998. Help for cytotoxic-T cell responses is mediated by CD40 signalling. Nature 393:478.[Medline]
- Ridge, J. P., Di Rosa, F. and Matzinger, P. 1998. A conditioned dendritic cell can be a temporal bridge between a CD4+ T-helper and a T-killer cell. Nature 393:474.[Medline]
-
Whitmire, J. K., Flavell, R. A., Grewal, I. S., Larsen, C. P., Pearson, T. C. and Ahmed, R. 1999. CD40CD40 ligand costimulation is required for generating antiviral CD4 T cell responses but is dispensable for CD8 T cell responses. J. Immunol. 163:3194.
[Abstract/Free Full Text] - Banchereau, J. and Steinman, R. M. 1998. Dendritic cells and the control of immunity. Nature 392:245.[Medline]
-
Labeur, M. S., Roters, B., Pers, B., Mehling, A., Luger, T. A., Schwarz, T. and Grabbe, S. 1999. Generation of tumor immunity by bone marrow-derived dendritic cells correlates with dendritic cell maturation stage. J. Immunol. 162:168.
[Abstract/Free Full Text] -
Mackey, M. F., Gunn, J. R., Maliszewski, C., Kikutani, H., Noelle, R. J. and Barth, R. J., Jr. 1998. Dendritic cells require maturation via CD40 to generate protective antitumor immunity. J. Immunol. 161:2094.
[Abstract/Free Full Text] -
Stuber, E., Strober, W. and Neurath, M. 1996. Blocking the CD40LCD40 interaction in vivo specifically prevents the priming of T helper 1 cells through the inhibition of interleukin 12 secretion. J. Exp. Med. 183:693.
[Abstract/Free Full Text] - Macatonia, S. E., Hosken, N. A., Litton, M., Vieira, P., Hsieh, C.-S., Culpepper, J. A., Wysocka, M., Trinchieri, G., Murphy, K. M. and O'Garra, A. 1995. Dendritic cells produce IL-12 and direct the development of Th1 cells from naive CD4+ T cells. J. Immunol. 154:5071.[Abstract]
- Trinchieri, G. 1998. Interleukin-12: a cytokine at the interface of inflammation and immunity. Adv. Immunol. 70:83.[Web of Science][Medline]
- Kuniyoshi, J. S., Kuniyoshi, C. J., Lim, A. M., Wang, F. Y., Bade, E. R., Lau, R., Thomas, E. K. and Weber, J. S. 1999. Dendritic cell secretion of IL-15 is induced by recombinant huCD40LT and augments the stimulation of antigen-specific cytolytic T cells. Cell. Immunol. 193:48.[Web of Science][Medline]
- Wu, Y. and Liu, Y. 1994. Viral induction of co-stimulatory activity on antigen-presenting cells bypasses the need for CD4 T cell help in CD8 T cell responses. Curr. Biol. 4:499.[Web of Science][Medline]
- Boog, C. J. P., Boes, J. and Melief, C. J. M. 1988. Stimulation with dendritic cells decreases or obviates the CD4+ helper cell requirement in cytotoxic T lymphocyte responses. Eur. J. Immunol. 18:219.[Web of Science][Medline]
-
Takahashi, H., Nakagawa, Y., Yokomuro, K. and Berzofsky, J. A. 1993. Induction of CD8+ CTL by immunization with syngeneic irradiated HIV-1 envelope derived peptide-pulsed dendritic cells. Int. Immunol. 5:849.
[Abstract/Free Full Text] -
Ludewig, B., Oehen, S., Barchiesi, F., Schwendener, R. A., Hengartner, H. and Zinkernagel, R. M. 1999. Protective antiviral cytotoxic T cell memory is most efficiently maintained by restimulation via dendritic cells. J. Immunol. 163:1839.
[Abstract/Free Full Text] - Binder, D. and Kündig, T. M. 1991. Antiviral protection by CD8+ versus CD4+ T cells: CD8+ T cells correlating with cytotoxic activity in vitro are more efficient in antivaccinia virus protection than CD4-dependent IL. J. Immunol. 146:4301.[Abstract]
-
Karupiah, G., Buller, R. M., van Rooijen, N., Duarte, C. J. and Chen, J. 1996. Different roles for CD4+ and CD8+ T lymphocytes and macrophage subsets in the control of a generalized virus infection. J. Virol. 70:8301.
[Abstract/Free Full Text] -
Rosenberg, E. S., Billingsley, J. M., Caliendo, A. M., Boswell, S. L., Sax, P. E., Kalams, S. A. and Walker, B. D. 1997. Vigorous HIV-1-specific CD4+ T cell responses associated with control of viremia [see Comments]. Science 278:1447.
[Abstract/Free Full Text] -
Ulmer, J. B., Fu, T.-M., Deck, R. R., Friedman, A., Guan, L., DeWitt, C., Liu, X., Wang, S., Liu, M. A., Donnelly, J. J. and Caulfield, M. J. 1998. Protective CD4+ and CD8+ T cells against influenza virus induced by vaccination with nucleoprotein DNA. J. Virol. 72:5648.
[Abstract/Free Full Text] -
Zajac, A. J., Blattman, J. N., Murali-Krishna, K., Sourdive, D. J. D., Suresh, M., Altman, J. D. and Ahmed, R. 1998. Viral immune evasion due to persistence of activated T cells without effector function. J. Exp. Med. 188:2205.
[Abstract/Free Full Text] - Leist, T. P., Kohler, M. and Zinkernagel, R. M. 1989. Impaired generation of anti-viral cytotoxicity against lymphocytic choriomeningitis and vaccinia virus in mice treated with CD4-specific monoclonal antibody. Scand. J. Immunol. 30:679.[Web of Science][Medline]
- Kirberg, J., Bruno, L. and Von Boehmer, H. 1993. CD4+8 help prevents rapid deletion of CD8+ cells after a transient response to antigen. Eur. J. Immunol. 23:1963.[Web of Science][Medline]
-
Eichelberger, M., Allan, W., Zijlstra, M., Jaenisch, R. and Doherty, P. C. 1991. Clearance of influenza virus respiratory infection in mice lacking class I major histocompatibility complex-restricted CD8+ T cells. J. Exp. Med. 174:875.
[Abstract/Free Full Text] -
Maloy, K. J., Burkhart, C., Freer, G., Rulicke, T., Pircher, H., Kono, D. H., Theofilopoulos, A. N., Ludewig, B., Hofmann-Rohrer, U., Zinkernagel, R. M. and Hengartner, H. 1999. Qualitative and quantitative requirements for CD4+ T cell-mediated antiviral protection. J. Immunol. 162:2867.
[Abstract/Free Full Text] -
van den Broek, M. F., Müller, U., Huang, S., Aguet, M. and Zinkernagel, R. M. 1995. Antiviral defense in mice lacking both alpha/beta and gamma interferon receptors. J. Virol. 69:4792.
[Abstract/Free Full Text] -
Planz, O., Ehl, S., Furrer, E., Horvath, E., Brundler, M. A., Hengartner, H. and Zinkernagel, R. M. 1997. A critical role for neutralizing-antibody-producing B cells, CD4(+) T cells, and interferons in persistent and acute infections of mice with lymphocytic choriomeningitis virus: implications for adoptive immunotherapy of virus carriers. Proc. Natl Acad. Sci. USA 94:6874.
[Abstract/Free Full Text] -
Herrath, M. G. V., Coon, B. and Oldstone, M. B. A. 1997. Low-affinity cytotoxic T-lymphocytes require IFN-
to clean an acute viral infection. Virology 229:349.[Web of Science][Medline]
-
Bot, A., Bot, S. and Bona, C. A. 1998. Protective role of gamma interferon during the recall response to influenza virus. J. Virol. 72:6637.
[Abstract/Free Full Text] -
Battegay, M., Moskophidis, D., Rahemtulla, A., Hengartner, H., Mak, T. W. and Zinkernagel, R. M. 1994. Enhanced establishment of a virus carrier state in adult CD4+ T cell-deficient mice. J. Virol. 68:4700.
[Abstract/Free Full Text] -
Kalams, S. A. and Walker, B. D. 1998. The critical need for CD4 help in maintaining effective cytotoxic T lymphocyte responses. J. Exp. Med. 188:2199.
[Free Full Text] -
von Herrath, M. G., Yokoyama, M., Dockter, J., Oldstone, M. B. A. and Whitton, J. L. 1996. CD4-deficient mice have reduced levels of memory cytotoxic T lymphocytes after immunization and show diminished resistance to subsequent virus challenge. J. Virol. 70:1072.
[Abstract/Free Full Text] -
Borrow, P., Tishon, A., Lee, S., Xu, J., Grewal, I. S., Oldstone, M. B. and Flavell, R. A. 1996. CD40L-deficient mice show deficits in antiviral immunity and have an impaired memory CD8+ CTL response. J. Exp. Med. 183:2129.
[Abstract/Free Full Text] -
Actor, J. K. D, Shirai, M., Kullberg, M. C., Buller, R. M. L., Sher, A. and Berzofsky, J. A. 1993. Helminth infection results in decreased virus-specific CD8+ cytotoxic T cell and Th1 cytokine responses as well as delayed virus clearance. Proc. Natl Acad. Sci. USA 90:948.
[Abstract/Free Full Text] -
Graham, M. B., Braciale, V. L. and Braciale, T. J. 1994. Influenza virus-specific CD4+ T helper type 2 T lymphocytes do not promote recovery from experimental virus infection. J. Exp. Med. 180:1273.
[Abstract/Free Full Text] - Mosmann, T. R. and Moore, K. W. 1991. The role of IL-10 in crossregulation of Th1 and Th2 responses. Immunol. Today 12:49.
- Fiorentino, D. F., Zlotnik, A., Mosmann, T. R., Howard, M. and O'Garra, A. 1991. IL-10 inhibits cytokine production by activated macrophages. J. Immunol. 147:3815.[Abstract]
- O'Garra, A. 1998. Cytokines induce the development of functionally heterogeneous T helper cell subsets. Immunity 8:275.[Web of Science][Medline]
-
Hsieh, C.-S., Macatonia, S. E., Tripp, C. S., Wolf, S. F., O'Garra, A. and Murphy, K. M. 1993. Development of Th1 CD4+ T cells through IL-12 produced by Listeria-induced macrophages. Science 260:547.
[Abstract/Free Full Text] -
Seder, R. A., Gazzinelli, R., Sher, A. and Paul, W. E. 1993. IL12 acts directly on CD4+ T cells to enhance priming for IFN
production and diminishes IL-4 inhibition of such priming. Proc. Natl Acad. Sci. USA 90:10188.[Abstract/Free Full Text] -
Schmitt, E., Hoehn, P., Huels, C., Goedert, S., Palm, N., Rüde, E. and Germann, T. 1994. T helper type 1 development of naive CD4+ T cells requires the coordinate action of interleukin-12 and interferon-
and is inhibited by transforming growth factor-ß. Eur. J. Immunol. 24:793.[Web of Science][Medline]
-
Wenner, C. A., Güler, M. L., Macatonia, S. E., O'Garra, A. and Murphy, K. M. 1996. Roles of IFN-
in IL-12-induced T helper cell-1 development. J. Immunol. 156:1442.[Abstract]
- Seder, R. A. 1994. Acquisition of lymphokine-producing phenotype by CD4+ T cells. J. Allergy Clin. Immunol. 94:1195.[Web of Science][Medline]
-
Hsieh, C.-S., Heimberger, A. B., Gold, J. S., O'Garra, A. and Murphy, K. M. 1992. Differential regulation of T helper phenotype development by interleukins 4 and 10 in an
ß T cell-receptor transgenic system. Proc. Natl Acad. Sci. USA 89:6065.[Abstract/Free Full Text] - Szabo, S. J., Jacobson, N. G., Dighe, A. S., Gubler, U. and Murphy, K. M. 1995. Developmental commitment to the Th2 lineage by extinction of IL-12 signaling. Immunity 2:665.[Web of Science][Medline]
-
Levings, M. K. and Schrader, J. W. 1999. IL-4 inhibits the production of TNF-
and IL-12 by STAT6-dependent and -independent mechanisms. J. Immunol. 162:5224.[Abstract/Free Full Text] -
Alexander-Miller, M. A., Leggatt, G. R. and Berzofsky, J. A. 1996. Selective expansion of high or low avidity cytotoxic T lymphocytes and efficacy for adoptive immunotherapy. Proc. Natl Acad. Sci. USA 93:4102.
[Abstract/Free Full Text] -
Belyakov, I. M., Derby, M. A., Ahlers, J. D., Kelsall, B. L., Earl, P., Moss, B., Strober, W. and Berzofsky, J. A. 1998. Mucosal immunization with HIV-1 peptide vaccine induces mucosal and systemic cytotoxic T lymphocytes and protective immunity in mice against intrarectal recombinant HIV-vaccinia challenge. Proc. Natl Acad. Sci. USA 95:1709.
[Abstract/Free Full Text] - Belyakov, I. M., Ahlers, J. D., Brandwein, B. Y., Earl, P., Kelsall, B. L., Moss, B., Strober, W. and Berzofsky, J. A. 1998. The importance of local mucosal HIV-specific CD8+ cytotoxic T lymphocytes for resistance to mucosalviral transmission in mice and enhancement of resistance by local administration of IL-12. J. Clin. Invest. 102:2072.[Web of Science][Medline]
-
Gately, M. K., Warrier, R. R., Honasoge, S., Carvajal, D. M., Faherty, D. A., Connaughton, S. E., Anderson, T. D., Sarmiento, U., Hubbard, B. R. and Murphy, M. 1994. Administration of recombinant IL-12 to normal mice enhances cytolytic lymphocyte activity and induces production of IFN-
in vivo. Int. Immunol. 6:157.[Abstract/Free Full Text] - Kim, J. J., Trivedi, N. N., Nottingham, L. K., Morrison, L., Tsai, A., Hu, Y., Mahalingam, S., Dang, K., Ahn, L., Doyle, N. K., Wilson, D. M., Chattergoon, M. A., Chalian, A. A., Boyer, J. D., Agadjanyan, M. G. and Weiner, D. B. 1998. Modulation of amplitude and direction of in vivo immune responses by co-administration of cytokine gene expression cassettes with DNA immunogens. Eur. J. Immunol. 28:1089.[Web of Science][Medline]
-
Callan, M. F. C., Tan, L., Annels, N., Ogg, G. S., Wilson, J. D. K., O'Callaghan, C. A., Steven, N., McMichael, A. J. and Rickinson, A. B. 1998. Direct visualization of antigen-specific CD8+ T cells during the primary immune response to EpsteinBarr virus in vivo. J Exp. Med. 187:1395.
[Abstract/Free Full Text] - Murali-Krishna, K., Altman, J. D., Suresh, M., Sourdive, D. J., Zajac, A. J., Miller, J. D., Slansky, J. and Ahmed, R. 1998. Counting antigen-specific CD8 T cells: a reevaluation of bystander activation during viral infection. Immunity 8:177.[Web of Science][Medline]
- Pantaleo, G., Demarest, J. F., Soudeyns, H., Graziosi, C., Denis, F., Adelsberger, J. W., Borrow, P., Saag, M. S., Shaw, G. M., Sekaly, R. P. and Fauci, A. S. 1994. Major expansion of CD8+ T cells with a predominant Vß usage during the primary immune response to HIV. Nature 370:463.[Medline]
-
Koup, R. A., Safrit, J. T., Cao, Y., Andrews, C. A., McLeod, G., Borkowsky, W., Farthing, C. and Ho, D. D. 1994. Temporal association of cellular immune responses with the initial control of viremia in primary human imunodeficiency virus type 1 syndrome. J. Virol. 68:4650.
[Abstract/Free Full Text] - Pircher, H., Moskophidis, D., Rohrer, U., Bürki, K., Hengartner, H. and Zinkernagel, R. M. 1990. Viral escape by selection of cytotoxic T cell-resistant virus variants in vivo. Nature 346:629.[Medline]
-
Zinkernagel, R. M. and Althage, A. 1977. Antiviral protection by virus-immune cytotoxic T cells: infected target cells are lysed before infectious virus progeny is assembled. J. Exp. Med. 145:644.
[Abstract/Free Full Text] - Borrow, P., Lewicki, H., Wei, X., Horwitz, M. S., Peffer, N., Meyers, H., Nelson, J. A., Gairin, J. E., Hahn, B. H., Oldstone, M. B. A. and Shaw, G. M. 1997. Antiviral pressure exerted by HIV-1-specific cytotoxic T lymphocytes (CTLs) during primary infection demonstrated by rapid selection of CTL escape virus. Nat. Med. 3:205.[Web of Science][Medline]
- Oxenius, A., Zinkernagel, R. M. and Hengartner, H. 1998. Comparison of activation versus induction of unresponsiveness of virus-specific CD4+ and CD8+ T cells upon acute versus persistent viral infection. Immunity 9:449.[Web of Science][Medline]
-
Bachmann, M. F., Kundig, T. M., Hengartner, H. and Zinkernagel, R. M. 1997. Protection against immunopathological consequences of a viral infection by activated but not resting cytotoxic T cells: T cell memory without `memory T cells'? Proc. Natl Acad. Sci. USA 94:640.
[Abstract/Free Full Text] -
Harris, N., Buller, R. M. and Karupiah, G. 1995. Gamma interferon-induced, nitric oxide-mediated inhibition of vaccinia virus replication. J Virol. 69:910.
[Abstract/Free Full Text] - Cella, M., Engering, A., Pinet, V., Pieters, J. and Lanzavecchia, A. 1997. Inflammatory stimuli induce accumulation of MHC class II complexes on dendritic cells. Nature 388:782.[Medline]
- Shu, U., Kiniwa, M., Wu, C. Y., Maliszewski, C., Vezzio, N., Hakimi, J., Gately, M. and Delespesse, G. 1995. Activated T cells induced inteleukin-12 production by monocytes via CD40CD40 ligand interaction. Eur. J. Immunol. 25:1125.[Web of Science][Medline]
-
Cella, M., Scheidegger, D., Palmer-Lehmann, K., Lane, P., Lanzavecchia, A. and Alber, G. 1996. Ligation of CD40 on dendritic cells triggers production of high levels of interleukin-12 and enhances T cell stimulatory capacity: TT help via APC activation. J. Exp. Med. 184:747.
[Abstract/Free Full Text] -
Shibuya, K., Robinson, D., Zonin, F., Hartley, S. B., Macatonia, S. E., Somoza, C., Hunter, C. A., Murphy, K. M. and O'Garra, A. 1998. IL-1
and TNF-
are required for IL-12-induced development of Th1 cells producing high levels of IFN-
in BALB/c but not C57BL/6 mice. J. Immunol. 160:1708.[Abstract/Free Full Text] -
Alexander-Miller, M. A., Derby, M. A., Sarin, A., Henkart, P. A. and Berzofsky, J. A. 1998. Supra-optimal peptide/MHC causes a decrease in Bcl-2 and allows TNF-
receptor II-mediated apoptosis of CTL. J. Exp. Med. 188:1391.[Abstract/Free Full Text] -
Hill, G. R., Teshima, T., Gerbitz, A., Pan, L., Cooke, K. R., Brinson, Y. S., Crawford, J. M. and Ferrara, J. L. M. 1999. Differential roles of IL-1 and TNF-
on graft-versus-host disease and graft versus leukemia. J. Clin. Invest. 104:459.[Web of Science][Medline]
-
Hsieh, C.-S., Macatonia, S. E., O'Garra, A. and Murphy, K. M. 1995. T cell genetic background determines default T helper phenotype development in vitro. J. Exp. Med. 181:713.
[Abstract/Free Full Text] -
Yip, H. C., Karulin, A. Y., Tary-Lehmann, M., Hesse, M. D., Radeke, H., Heeger, P. S., Trezza, R. P., Heinzel, F. P., Forsthuber, T. and Lehmann, P. V. 1999. Adjuvant-guided type-1 and type-2 immunity: infectious/noninfectious dichotomy defines the class of response. J. Immunol. 162:3942.
[Abstract/Free Full Text] -
Belyakov, I. M., Ahlers, J. D., Clements, J. D., Strober, W. and Berzofsky, J. A.2000. Interplay of cytokines and adjuvants in the regulation of mucosal and systemic HIV-specific cytotoxic T lymphocytes. J. Immunol. 165:6454.
[Abstract/Free Full Text]
This article has been cited by other articles:
![]() |
M. Trilling, V. T. K. Le, A. Zimmermann, H. Ludwig, K. Pfeffer, G. Sutter, G. L. Smith, and H. Hengel Gamma Interferon-Induced Interferon Regulatory Factor 1-Dependent Antiviral Response Inhibits Vaccinia Virus Replication in Mouse but Not Human Fibroblasts J. Virol., April 15, 2009; 83(8): 3684 - 3695. [Abstract] [Full Text] [PDF] |
||||
![]() |
I. M. Belyakov, S. Kozlowski, M. Mage, J. D. Ahlers, L. F. Boyd, D. H. Margulies, and J. A. Berzofsky Role of {alpha}3 domain of class I MHC molecules in the activation of high- and low-avidity CD8+ CTLs Int. Immunol., December 1, 2007; 19(12): 1413 - 1420. [Abstract] [Full Text] [PDF] |
||||
![]() |
I. M. Belyakov, D. Isakov, Q. Zhu, A. Dzutsev, and J. A. Berzofsky A Novel Functional CTL Avidity/Activity Compartmentalization to the Site of Mucosal Immunization Contributes to Protection of Macaques against Simian/Human Immunodeficiency Viral Depletion of Mucosal CD4+ T Cells J. Immunol., June 1, 2007; 178(11): 7211 - 7221. [Abstract] [Full Text] [PDF] |
||||
![]() |
R. S. Kornbluth and G. W. Stone Immunostimulatory combinations: designing the next generation of vaccine adjuvants J. Leukoc. Biol., November 1, 2006; 80(5): 1084 - 1102. [Abstract] [Full Text] [PDF] |
||||
![]() |
E. Andreakos, R. O. Williams, J. Wales, B. M. Foxwell, and M. Feldmann Activation of NF-{kappa}B by the intracellular expression of NF-{kappa}B-inducing kinase acts as a powerful vaccine adjuvant PNAS, September 26, 2006; 103(39): 14459 - 14464. [Abstract] [Full Text] [PDF] |
||||
![]() |
J. Botten, J. Alexander, V. Pasquetto, J. Sidney, P. Barrowman, J. Ting, B. Peters, S. Southwood, B. Stewart, M. P. Rodriguez-Carreno, et al. Identification of Protective Lassa Virus Epitopes That Are Restricted by HLA-A2 J. Virol., September 1, 2006; 80(17): 8351 - 8361. [Abstract] [Full Text] [PDF] |
||||
![]() |
J. W. Hodge, M. Chakraborty, C. Kudo-Saito, C. T. Garnett, and J. Schlom Multiple Costimulatory Modalities Enhance CTL Avidity J. Immunol., May 15, 2005; 174(10): 5994 - 6004. [Abstract] [Full Text] [PDF] |
||||
![]() |
J. T. Snyder, I. M. Belyakov, A. Dzutsev, F. Lemonnier, and J. A. Berzofsky Protection against Lethal Vaccinia Virus Challenge in HLA-A2 Transgenic Mice by Immunization with a Single CD8+ T-Cell Peptide Epitope of Vaccinia and Variola Viruses J. Virol., July 1, 2004; 78(13): 7052 - 7060. [Abstract] [Full Text] [PDF] |
||||
![]() |
P. Daftarian, S. Ali, R. Sharan, S. F. Lacey, C. La Rosa, J. Longmate, C. Buck, R. F. Siliciano, and D. J. Diamond Immunization with Th-CTL Fusion Peptide and Cytosine-Phosphate-Guanine DNA in Transgenic HLA-A2 Mice Induces Recognition of HIV-Infected T Cells and Clears Vaccinia Virus Challenge J. Immunol., October 15, 2003; 171(8): 4028 - 4039. [Abstract] [Full Text] [PDF] |
||||
![]() |
T. Okazaki, C. D. Pendleton, F. Lemonnier, and J. A. Berzofsky Epitope-Enhanced Conserved HIV-1 Peptide Protects HLA-A2-Transgenic Mice Against Virus Expressing HIV-1 Antigen J. Immunol., September 1, 2003; 171(5): 2548 - 2555. [Abstract] [Full Text] [PDF] |
||||
![]() |
J. D. Ahlers, I. M. Belyakov, M. Terabe, R. Koka, D. D. Donaldson, E. K. Thomas, and J. A. Berzofsky A push-pull approach to maximize vaccine efficacy: Abrogating suppression with an IL-13 inhibitor while augmenting help with granulocyte/macrophage colony-stimulating factor and CD40L PNAS, October 1, 2002; 99(20): 13020 - 13025. [Abstract] [Full Text] [PDF] |
||||
![]() |
J. D. Ahlers, I. M. Belyakov, S. Matsui, and J. A. Berzofsky Signals delivered through TCR instruct IL-12 receptor (IL-12R) expression: IL-12 and tumor necrosis factor-{alpha} synergize for IL-12R expression at low antigen dose Int. Immunol., November 1, 2001; 13(11): 1433 - 1442. [Abstract] [Full Text] [PDF] |
||||
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||










